SCOPe 2.03: Domain d3bfdd_: 3bfd D:

Lineage for d3bfdd_ (3bfd D:)

1. Root: SCOPe 2.03

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (19 species)
   not a true protein

7. Species Citrobacter sedlakii [TaxId:67826] [188289] (5 PDB entries)

8. Domain d3bfdd_: 3bfd D: [172585]
   automated match to d1iyoa_
   complexed with cac; mutant

Details for d3bfdd_

PDB Entry: 3bfd, 2 Å

PDB Description: crystal structure of the class a beta-lactamase sed-g238c mutant from citrobacter sedlakii

PDB Compounds: (D:) Class A beta-lactamase Sed1

SCOPe Domain Sequences for d3bfdd_:

Sequence; same for both SEQRES and ATOM records:

>d3bfdd_ e.3.1.1 (D:) automated matches {Citrobacter sedlakii [TaxId: 67826]}
dvqqvqkklaalekqsggrlgvalintadnsqvlyraderfamcstskvmtaaavlkqse
thdgilqqkmtikkadltnwnpvtekyvgntmtlaelsaatlqysdntamnkllahlggp
gnvtafarsigdttfrldrkepelntaipgderdttsplamakslrkltlgdalagpqra
qlvdwlkgnttggqsiraglpahwvvgdktgacdygttndiaviwpedraplvlvtyftq
pqqdakwrkdvlaaaakivtegk

Timeline for d3bfdd_:

• d3bfdd_ first appeared in SCOPe 2.01
  
• d3bfdd_ appears in SCOPe 2.02
  
• d3bfdd_ appears in SCOPe 2.04
  
• d3bfdd_ appears in the current release, SCOPe 2.08