SCOP 1.63: Domain d2scpa_: 2scp A:

Lineage for d2scpa_ (2scp A:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (9 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (17 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Sarcoplasmic calcium-binding protein [47509] (2 species)

7. Species Sandworm (Nereis diversicolor) [TaxId:126592] [47510] (1 PDB entry)

8. Domain d2scpa_: 2scp A: [17256]

Details for d2scpa_

PDB Entry: 2scp, 2 Å

PDB Description: structure of a sarcoplasmic calcium-binding protein from nereis diversicolor refined at 2.0 angstroms resolution

SCOP Domain Sequences for d2scpa_:

Sequence; same for both SEQRES and ATOM records:

>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor)}
sdlwvqkmktyfnridfdkdgaitrmdfesmaerfakesemkaehakvlmdsltgvwdnf
ltavaggkgidettfinsmkemvknpeaksvvegplplffravdtnednnisrdeygiff
gmlgldktmapasfdaidtnndgllsleefviagsdffmndgdstnkvfwgplv

Timeline for d2scpa_:

• d2scpa_ first appeared (with stable ids) in SCOP 1.55
  
• d2scpa_ appears in SCOP 1.61
  
• d2scpa_ appears in SCOP 1.65
  
• d2scpa_ appears in the current release, SCOPe 2.08