SCOP 1.73: Domain d1rroa_: 1rro A:

Lineage for d1rroa_ (1rro A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.4: Parvalbumin [47492] (2 proteins)
   6-helices; array of 3 hairpins, closed
   made with two-helical hairpin and two EF-hands

6. Protein Oncomodulin [47493] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [47494] (2 PDB entries)

8. Domain d1rroa_: 1rro A: [17195]
   complexed with ca

Details for d1rroa_

PDB Entry: 1rro, 1.3 Å

PDB Description: refinement of recombinant oncomodulin at 1.30 angstroms resolution

PDB Compounds: (A:) rat oncomodulin

SCOP Domain Sequences for d1rroa_:

Sequence; same for both SEQRES and ATOM records:

>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]}
sitdilsaediaaalqecqdpdtfepqkffqtsglskmsasqvkdifrfidndqsgyldg
delkyflqkfqsdareltesetkslmdaadndgdgkigadefqemvhs

Timeline for d1rroa_:

• d1rroa_ first appeared (with stable ids) in SCOP 1.55, called d1rro__
  
• d1rroa_ was called d1rro__ in SCOP 1.71
  
• d1rroa_ appears in SCOP 1.75
  
• d1rroa_ appears in the current release, SCOPe 2.08