SCOPe 2.08: Domain d3able_: 3abl E:

Lineage for d3able_ (3abl E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families)
   automatically mapped to Pfam PF02284

5. Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)

6. Protein Cytochrome c oxidase subunit E [48481] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48482] (50 PDB entries)

8. Domain d3able_: 3abl E: [171949]
   Other proteins in same PDB: d3abla_, d3ablb1, d3ablb2, d3ablc_, d3abld_, d3ablf_, d3ablg_, d3ablh_, d3abli_, d3ablj_, d3ablk_, d3abll_, d3ablm_, d3abln_, d3ablo1, d3ablo2, d3ablp_, d3ablq_, d3abls_, d3ablt_, d3ablu_, d3ablv_, d3ablw_, d3ablx_, d3ably_, d3ablz_
   automated match to d1occe_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d3able_

PDB Entry: 3abl, 2.1 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (15-s X-ray exposure dataset)

PDB Compounds: (E:) Cytochrome c oxidase subunit 5A

SCOPe Domain Sequences for d3able_:

Sequence; same for both SEQRES and ATOM records:

>d3able_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
etdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasav
rilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

Timeline for d3able_:

• d3able_ first appeared in SCOPe 2.01
  
• d3able_ appears in SCOPe 2.07