Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (31 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [189205] (16 PDB entries) |
Domain d3a4sc_: 3a4s C: [171726] Other proteins in same PDB: d3a4sa_, d3a4sb1, d3a4sb2 automated match to d1wm2a_ protein/RNA complex |
PDB Entry: 3a4s (more details), 2.7 Å
SCOPe Domain Sequences for d3a4sc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a4sc_ d.15.1.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qelrlrvqgkekhqmleislspdsplkvlmshyeeamglsghklsfffdgtklsgkelpa dlglesgdlievwg
Timeline for d3a4sc_:
View in 3D Domains from other chains: (mouse over for more information) d3a4sa_, d3a4sb1, d3a4sb2, d3a4sd_ |