Lineage for d3a05a_ (3a05 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2469071Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2469072Protein automated matches [190459] (59 species)
    not a true protein
  7. 2469102Species Aeropyrum pernix [TaxId:56636] [189259] (3 PDB entries)
  8. 2469105Domain d3a05a_: 3a05 A: [171623]
    automated match to d1ulhb_
    protein/RNA complex; complexed with cd, sf4, trp

Details for d3a05a_

PDB Entry: 3a05 (more details), 2.2 Å

PDB Description: Crystal structure of tryptophanyl-tRNA synthetase from hyperthermophilic archaeon, Aeropyrum pernix K1 complex with tryptophan
PDB Compounds: (A:) Tryptophanyl-tRNA synthetase

SCOPe Domain Sequences for d3a05a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a05a_ c.26.1.0 (A:) automated matches {Aeropyrum pernix [TaxId: 56636]}
ldpwgaveikdydrllrtfgirpfsevlpllrkagmepsflmrrgiifghrdfdkileak
argervavltgfmpsgkfhfghkltvdqliylqkngfkvfvaiadaeafavrrigreeav
riaveeyianmialgldpkdtefyfqtnrgtpyfrliqlfsgkvtaaemeaiygeltpak
mmasltqaadilhvqldeyggyrhvvvpvgadqdphlrltrdladrmagvvelerpasty
hklqpgldgrkmsssrpdstifltdppevarnklfraltggrataeeqrrlggvpevcsv
yhmdlyhlmpddgevkhiytscrlgkilcgeckqiaweklerflaehqsrlekaktiawk
lvepprf

SCOPe Domain Coordinates for d3a05a_:

Click to download the PDB-style file with coordinates for d3a05a_.
(The format of our PDB-style files is described here.)

Timeline for d3a05a_: