SCOPe 2.03: Domain d3a01b_: 3a01 B:

Lineage for d3a01b_ (3a01 B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein automated matches [190360] (2 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187191] (5 PDB entries)

8. Domain d3a01b_: 3a01 B: [171618]
   automated match to d1fjla_
   protein/DNA complex

Details for d3a01b_

PDB Entry: 3a01, 2.7 Å

PDB Description: Crystal structure of Aristaless and Clawless homeodomains bound to DNA

PDB Compounds: (B:) Homeobox protein aristaless

SCOPe Domain Sequences for d3a01b_:

Sequence; same for both SEQRES and ATOM records:

>d3a01b_ a.4.1.1 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rryrttftsfqleelekafsrthypdvftreelamkiglteariqvwfqnrrakwrk

Timeline for d3a01b_:

• d3a01b_ first appeared in SCOPe 2.01
  
• d3a01b_ appears in SCOPe 2.02
  
• d3a01b_ appears in SCOPe 2.04
  
• d3a01b_ appears in the current release, SCOPe 2.08