Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein automated matches [190329] (6 species) not a true protein |
Species Brachyopsis rostratus [TaxId:412977] [188571] (1 PDB entry) |
Domain d2ziba_: 2zib A: [171237] automated match to d2afpa_ complexed with so4 |
PDB Entry: 2zib (more details), 1.34 Å
SCOPe Domain Sequences for d2ziba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ziba_ d.169.1.1 (A:) automated matches {Brachyopsis rostratus [TaxId: 412977]} hhhalvcpagwtlhgqrcfyseatamtwdlaeancvnkgghlasihsleeqlyikdivag ivwiggsackvagawswtdgtpvdyrtwcptkpndilsdccmqmtaavdkcwddlpcpas hasicakaai
Timeline for d2ziba_: