SCOPe 2.03: Domain d2ziba_: 2zib A:

Lineage for d2ziba_ (2zib A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein automated matches [190329] (6 species)
   not a true protein

7. Species Brachyopsis rostratus [TaxId:412977] [188571] (1 PDB entry)

8. Domain d2ziba_: 2zib A: [171237]
   automated match to d2afpa_
   complexed with so4

Details for d2ziba_

PDB Entry: 2zib, 1.34 Å

PDB Description: Crystal structure analysis of calcium-independent type II antifreeze protein

PDB Compounds: (A:) Type II antifreeze protein

SCOPe Domain Sequences for d2ziba_:

Sequence; same for both SEQRES and ATOM records:

>d2ziba_ d.169.1.1 (A:) automated matches {Brachyopsis rostratus [TaxId: 412977]}
hhhalvcpagwtlhgqrcfyseatamtwdlaeancvnkgghlasihsleeqlyikdivag
ivwiggsackvagawswtdgtpvdyrtwcptkpndilsdccmqmtaavdkcwddlpcpas
hasicakaai

Timeline for d2ziba_:

• d2ziba_ first appeared in SCOPe 2.01
  
• d2ziba_ appears in SCOPe 2.02
  
• d2ziba_ appears in SCOPe 2.04
  
• d2ziba_ appears in the current release, SCOPe 2.08, called d2ziba1