Lineage for d2yzha_ (2yzh A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1602360Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1602361Protein automated matches [190056] (133 species)
    not a true protein
  7. 1602416Species Aquifex aeolicus [TaxId:224324] [188265] (2 PDB entries)
  8. 1602417Domain d2yzha_: 2yzh A: [170940]
    automated match to d1psqa_
    complexed with so4

Details for d2yzha_

PDB Entry: 2yzh (more details), 1.85 Å

PDB Description: Crystal structure of peroxiredoxin-like protein from Aquifex aeolicus
PDB Compounds: (A:) Probable thiol peroxidase

SCOPe Domain Sequences for d2yzha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yzha_ c.47.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]}
ghmartvnlkgnpvtlvgpelkvgdrapeavvvtkdlqekivggakdvvqviitvpsldt
pvcetetkkfneimagmegvdvtvvsmdlpfaqkrfcesfniqnvtvasdfryrdmekyg
vligegalkgilaravfiidkegkvayvqlvpeiteepnydevvnkvkel

SCOPe Domain Coordinates for d2yzha_:

Click to download the PDB-style file with coordinates for d2yzha_.
(The format of our PDB-style files is described here.)

Timeline for d2yzha_: