Class a: All alpha proteins [46456] (285 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins) lacks the first helix of canonical fold 3 helices; bundle, partly opened, right-handed twist |
Protein Purine repressor (PurR), N-terminal domain [47439] (1 species) |
Species Escherichia coli [TaxId:562] [47440] (24 PDB entries) |
Domain d1bdia1: 1bdi A:3-58 [17092] Other proteins in same PDB: d1bdia2 protein/DNA complex; complexed with hpa; mutant |
PDB Entry: 1bdi (more details), 3 Å
SCOPe Domain Sequences for d1bdia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bdia1 a.35.1.5 (A:3-58) Purine repressor (PurR), N-terminal domain {Escherichia coli [TaxId: 562]} tikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkvnh
Timeline for d1bdia1: