Lineage for d2yr1a_ (2yr1 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2444934Species Geobacillus kaustophilus [TaxId:235909] [188221] (1 PDB entry)
  8. 2444935Domain d2yr1a_: 2yr1 A: [170870]
    automated match to d1gqna_

Details for d2yr1a_

PDB Entry: 2yr1 (more details), 2 Å

PDB Description: Crystal Structure of 3-dehydroquinate dehydratase from Geobacillus kaustophilus HTA426
PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d2yr1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yr1a_ c.1.10.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
mnispkaikvrniwiggtepcicapvvgeddrkvlreaeevcrkqpdllewradffraid
dqervlatanglrniageipilftirsereggqpiplneaevrrlieaicrsgaidlvdy
elaygeriadvrrmteecsvwlvvsrhyfdgtprketlladmrqaerygadiakvavmpk
spedvlvllqateearrelaiplitmamgglgaitrlagwlfgsavtfavgnqssapgqi
piddvrtvlsilqtysr

SCOPe Domain Coordinates for d2yr1a_:

Click to download the PDB-style file with coordinates for d2yr1a_.
(The format of our PDB-style files is described here.)

Timeline for d2yr1a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2yr1b_