Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins) Pfam PF00866 |
Protein automated matches [190223] (3 species) not a true protein |
Species Burkholderia xenovorans [TaxId:266265] [189543] (7 PDB entries) |
Domain d2yfjb_: 2yfj B: [170775] Other proteins in same PDB: d2yfja1, d2yfja2, d2yfjc1, d2yfjc2, d2yfje1, d2yfje2, d2yfjg1, d2yfjg2, d2yfji1, d2yfji2, d2yfjk1, d2yfjk2 automated match to d1wqlb1 complexed with 1it, fe2, fes |
PDB Entry: 2yfj (more details), 2.15 Å
SCOPe Domain Sequences for d2yfjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yfjb_ d.17.4.4 (B:) automated matches {Burkholderia xenovorans [TaxId: 266265]} fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff
Timeline for d2yfjb_: