Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.6: KA1-like [103243] (3 families) contains a single copy of this fold |
Family d.129.6.2: Ssp2 C-terminal domain-like [160723] (4 proteins) PfamB PB166430 |
Protein automated matches [190788] (2 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [188043] (5 PDB entries) |
Domain d2y8la1: 2y8l A:396-544 [170697] Other proteins in same PDB: d2y8la2, d2y8la3, d2y8lb_, d2y8le1, d2y8le2 automated match to d2v8qa1 complexed with adp, amp |
PDB Entry: 2y8l (more details), 2.5 Å
SCOPe Domain Sequences for d2y8la1:
Sequence, based on SEQRES records: (download)
>d2y8la1 d.129.6.2 (A:396-544) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} whlgirsqsrpndimaevcraikqldyewkvvnpyylrvrrknpvtstfskmslqlyqvd srtylldfrsiddeiteaksgtatpqrsgsisnyrscqrsdsdaeaqgkpsevsltssvt sldsspvdvaprpgshtieffemcanlik
>d2y8la1 d.129.6.2 (A:396-544) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} whlgirsqsrpndimaevcraikqldyewkvvnpyylrvrrknpvtstfskmslqlyqvd srtylldfrsiddevaprpgshtieffemcanlik
Timeline for d2y8la1: