Class a: All alpha proteins [46456] (289 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.3: SinR domain-like [47432] (9 proteins) |
Protein SinR repressor, DNA-binding domain [47433] (1 species) |
Species Bacillus subtilis [TaxId:1423] [47434] (1 PDB entry) |
Domain d1b0na2: 1b0n A:1-68 [17064] Other proteins in same PDB: d1b0na1, d1b0nb_ CASP3 complexed with zn |
PDB Entry: 1b0n (more details), 1.9 Å
SCOPe Domain Sequences for d1b0na2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b0na2 a.35.1.3 (A:1-68) SinR repressor, DNA-binding domain {Bacillus subtilis [TaxId: 1423]} migqrikqyrkekgyslselaekagvaksylssiernlqtnpsiqflekvsavldvsvht lldekhet
Timeline for d1b0na2: