Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
Protein automated matches [190545] (9 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [187720] (5 PDB entries) |
Domain d2xv0a_: 2xv0 A: [170413] automated match to d1cc3a_ complexed with cu1 |
PDB Entry: 2xv0 (more details), 1.6 Å
SCOPe Domain Sequences for d2xv0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xv0a_ b.6.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffcaahaamkg tltlk
Timeline for d2xv0a_: