Lineage for d2xshh_ (2xsh H:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543372Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2543693Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 2543749Protein automated matches [190223] (5 species)
    not a true protein
  7. 2543750Species Burkholderia xenovorans [TaxId:266265] [189543] (9 PDB entries)
  8. 2543766Domain d2xshh_: 2xsh H: [170355]
    Other proteins in same PDB: d2xsha1, d2xsha2, d2xshc1, d2xshc2, d2xshe1, d2xshe2, d2xshg1, d2xshg2, d2xshi1, d2xshi2, d2xshk1, d2xshk2
    automated match to d1wqlb1
    complexed with dc5, fe2, fes

Details for d2xshh_

PDB Entry: 2xsh (more details), 2.29 Å

PDB Description: crystal structure of p4 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 in complex with 2,6 di chlorobiphenyl
PDB Compounds: (H:) Biphenyl dioxygenase subunit beta

SCOPe Domain Sequences for d2xshh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xshh_ d.17.4.4 (H:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire
geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf
evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff

SCOPe Domain Coordinates for d2xshh_:

Click to download the PDB-style file with coordinates for d2xshh_.
(The format of our PDB-style files is described here.)

Timeline for d2xshh_: