Lineage for d1cqta2 (1cqt A:2-75)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 442266Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 442267Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (6 families) (S)
  5. 442268Family a.35.1.1: POU-specific domain [47414] (3 proteins)
  6. 442273Protein Oct-1 [47415] (1 species)
    canonical 4-helical fold
  7. 442274Species Human (Homo sapiens) [TaxId:9606] [47416] (7 PDB entries)
  8. 442280Domain d1cqta2: 1cqt A:2-75 [17018]
    Other proteins in same PDB: d1cqta1, d1cqtb1

Details for d1cqta2

PDB Entry: 1cqt (more details), 3.2 Å

PDB Description: crystal structure of a ternary complex containing an oca-b peptide, the oct-1 pou domain, and an octamer element

SCOP Domain Sequences for d1cqta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqta2 a.35.1.1 (A:2-75) Oct-1 {Human (Homo sapiens)}
epsdleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknmc
klkpllekwlndae

SCOP Domain Coordinates for d1cqta2:

Click to download the PDB-style file with coordinates for d1cqta2.
(The format of our PDB-style files is described here.)

Timeline for d1cqta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cqta1