SCOP 1.69: Domain d1cqta1: 1cqt A:102-161

Lineage for d1cqta1 (1cqt A:102-161)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (13 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (23 proteins)

6. Protein Oct-1 POU Homeodomain [46699] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46700] (7 PDB entries)

8. Domain d1cqta1: 1cqt A:102-161 [15992]
   Other proteins in same PDB: d1cqta2, d1cqtb2

Details for d1cqta1

PDB Entry: 1cqt, 3.2 Å

PDB Description: crystal structure of a ternary complex containing an oca-b peptide, the oct-1 pou domain, and an octamer element

SCOP Domain Sequences for d1cqta1:

Sequence; same for both SEQRES and ATOM records:

>d1cqta1 a.4.1.1 (A:102-161) Oct-1 POU Homeodomain {Human (Homo sapiens)}
rkkrtsietnirvaleksflenqkptseeitmiadqlnmekevirvwfcnrrqkekrinp

Timeline for d1cqta1:

• d1cqta1 first appeared (with stable ids) in SCOP 1.55
  
• d1cqta1 appears in SCOP 1.67
  
• d1cqta1 appears in SCOP 1.71
  
• d1cqta1 appears in the current release, SCOPe 2.08