![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) |
![]() | Superfamily f.4.3: Porins [56935] (4 families) ![]() |
![]() | Family f.4.3.1: Porin [56936] (2 proteins) trimer, one subunit folds into (16,20) barrel |
![]() | Protein automated matches [190289] (4 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [187889] (6 PDB entries) |
![]() | Domain d2xe2b_: 2xe2 B: [170050] automated match to d1osma_ complexed with oes; mutant |
PDB Entry: 2xe2 (more details), 2.5 Å
SCOPe Domain Sequences for d2xe2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xe2b_ f.4.3.1 (B:) automated matches {Escherichia coli [TaxId: 562]} aeiynkdgnkldlygkvdglhyfsdndskdgdktymrlgfkgetqvtdqltgygqweyqi qgnepesdnsswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtydsdnf mqqrgngfatyrntdffglvdgldfavqyqgkngsahgegmttngrddvfeqngdgvggs itynyegfgigaavssskrtwdqnntgligtgdraetytgglkydanniylaaqytqtyn atrvgslgwankaqnfeavaqyqfdfglrpslaylqskgknlgrgyddedilkyvdvgat yyfnknmstyvdykinllddnrftrdagintddivalglvyqf
Timeline for d2xe2b_: