Lineage for d2xb9b_ (2xb9 B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1588434Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 1588435Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
    automatically mapped to Pfam PF01220
  6. 1588548Protein automated matches [190071] (5 species)
    not a true protein
  7. 1588551Species Helicobacter pylori [TaxId:210] [187015] (7 PDB entries)
  8. 1588559Domain d2xb9b_: 2xb9 B: [169988]
    automated match to d1j2ya_
    complexed with cit, xnw

Details for d2xb9b_

PDB Entry: 2xb9 (more details), 2.75 Å

PDB Description: structure of helicobacter pylori type ii dehydroquinase in complex with inhibitor compound (2r)-2-(4-methoxybenzyl)-3-dehydroquinic acid
PDB Compounds: (B:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d2xb9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xb9b_ c.23.13.1 (B:) automated matches {Helicobacter pylori [TaxId: 210]}
mkilviqgpnlnmlghrdprlygmvtldqiheimqtfvkqgnldveleffqtnfegeiid
kiqesvgsdyegiiinpgafshtsiaiadaimlagkpvievhltniqareefrknsytga
acggvimgfgplgynmalmamvnilaemkafqeaqknn

SCOPe Domain Coordinates for d2xb9b_:

Click to download the PDB-style file with coordinates for d2xb9b_.
(The format of our PDB-style files is described here.)

Timeline for d2xb9b_: