Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries) |
Domain d2x89g1: 2x89 G:7-97 [169942] Other proteins in same PDB: d2x89a1, d2x89a2, d2x89b1, d2x89b2, d2x89c1, d2x89c2, d2x89d2, d2x89e2, d2x89f2, d2x89g2 automated match to d1a1mb_ |
PDB Entry: 2x89 (more details), 2.16 Å
SCOPe Domain Sequences for d2x89g1:
Sequence, based on SEQRES records: (download)
>d2x89g1 b.1.1.2 (G:7-97) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdwsfylly yteftptekdeyacrvnhvtlsqpkivkwdr
>d2x89g1 b.1.1.2 (G:7-97) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqvysrhpgksnflncyvsgfhpsdievdllkngeriekvehsdlsfwsfyllyyteftp tekdeyacrvnhvtlsqpkivkwdr
Timeline for d2x89g1: