Lineage for d2x82c_ (2x82 C:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1273716Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 1273717Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 1273718Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 1273825Protein automated matches [190369] (6 species)
    not a true protein
  7. 1273852Species Human immunodeficiency virus type 2 (isolate d194) [TaxId:11713] [189055] (2 PDB entries)
  8. 1273857Domain d2x82c_: 2x82 C: [169934]
    automated match to d1m9ec_

Details for d2x82c_

PDB Entry: 2x82 (more details), 2.6 Å

PDB Description: evolutionary basis of hiv restriction by the antiretroviral trimcyp
PDB Compounds: (C:) capsid protein p24

SCOPe Domain Sequences for d2x82c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x82c_ a.73.1.1 (C:) automated matches {Human immunodeficiency virus type 2 (isolate d194) [TaxId: 11713]}
pvqhvggtythiplsprtlnawvklveekkfgaevvpgfqalsegctpydinqmlncvgd
hqaamqiireiineeaaewdvqhpipagplpagqlreprgsdiagttstveeqiqwmfrp
qnpvpvgniyrrwiqiglqkcvrmy

SCOPe Domain Coordinates for d2x82c_:

Click to download the PDB-style file with coordinates for d2x82c_.
(The format of our PDB-style files is described here.)

Timeline for d2x82c_: