![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
![]() | Family a.29.2.1: Bromodomain [47371] (6 proteins) |
![]() | Protein TAFII250 double bromodomain module [47377] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47378] (2 PDB entries) |
![]() | Domain d1eqfa2: 1eqf A:1498-1625 [16973] complexed with so4 |
PDB Entry: 1eqf (more details), 2.1 Å
SCOPe Domain Sequences for d1eqfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} llddddqvafsfildnivtqkmmavpdswpfhhpvnkkfvpdyykvivnpmdletirkni skhkyqsresflddvnlilansvkyngpesqytktaqeivnvcyqtlteydehltqlekd ictakeaa
Timeline for d1eqfa2: