Lineage for d1f68a_ (1f68 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2319938Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2319939Family a.29.2.1: Bromodomain [47371] (6 proteins)
  6. 2319999Protein GCN5 [47372] (2 species)
  7. 2320002Species Human (Homo sapiens) [TaxId:9606] [47374] (1 PDB entry)
  8. 2320003Domain d1f68a_: 1f68 A: [16970]

Details for d1f68a_

PDB Entry: 1f68 (more details)

PDB Description: nmr solution structure of the bromodomain from human gcn5
PDB Compounds: (A:) histone acetyltransferase

SCOPe Domain Sequences for d1f68a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f68a_ a.29.2.1 (A:) GCN5 {Human (Homo sapiens) [TaxId: 9606]}
gdqlyttlknllaqikshpsawpfmepvkkseapdyyevirfpidlktmterlrsryyvt
rklfvadlqrviancreynppdseycrcasalekffyfklkeg

SCOPe Domain Coordinates for d1f68a_:

Click to download the PDB-style file with coordinates for d1f68a_.
(The format of our PDB-style files is described here.)

Timeline for d1f68a_: