SCOPe 2.03: Domain d2wu2c_: 2wu2 C:

Lineage for d2wu2c_ (2wu2 C:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families)
   two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains

5. Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (4 proteins)
   consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups

6. Protein Succinate dehydrogenase subunit SdhC [82870] (1 species)
   Cytochrome b556 subunit

7. Species Escherichia coli [TaxId:562] [82871] (7 PDB entries)

8. Domain d2wu2c_: 2wu2 C: [169627]
   Other proteins in same PDB: d2wu2a1, d2wu2a2, d2wu2a3, d2wu2b1, d2wu2b2, d2wu2d_, d2wu2e1, d2wu2e2, d2wu2e3, d2wu2f1, d2wu2f2, d2wu2h_, d2wu2i1, d2wu2i2, d2wu2i3, d2wu2j1, d2wu2j2, d2wu2l_
   automated match to d1nekc_
   complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant

Details for d2wu2c_

PDB Entry: 2wu2, 2.5 Å

PDB Description: crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhc his84met mutant

PDB Compounds: (C:) succinate dehydrogenase cytochrome b556 subunit

SCOPe Domain Sequences for d2wu2c_:

Sequence; same for both SEQRES and ATOM records:

>d2wu2c_ f.21.2.2 (C:) Succinate dehydrogenase subunit SdhC {Escherichia coli [TaxId: 562]}
qrpvnldlqtirfpitaiasilhrvsgvitfvavgillwllgtslsspegfeqasaimgs
ffvkfimwgiltalaymvvvgirhmmmdfgyleetfeagkrsakisfvitvvlsllagvl
vw

Timeline for d2wu2c_:

• d2wu2c_ first appeared in SCOPe 2.01
  
• d2wu2c_ appears in SCOPe 2.02
  
• d2wu2c_ appears in SCOPe 2.04
  
• d2wu2c_ appears in the current release, SCOPe 2.08