SCOPe 2.04: Domain d2wrsa_: 2wrs A:

Lineage for d2wrsa_ (2wrs A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein automated matches [190079] (7 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [189349] (15 PDB entries)

8. Domain d2wrsa_: 2wrs A: [169602]
   automated match to d1ko2a_
   complexed with cit, flc, zn

Details for d2wrsa_

PDB Entry: 2wrs, 2.79 Å

PDB Description: Crystal Structure of the Mono-Zinc Metallo-beta-lactamase VIM-4 from Pseudomonas aeruginosa

PDB Compounds: (A:) beta-lactamase vim-4

SCOPe Domain Sequences for d2wrsa_:

Sequence; same for both SEQRES and ATOM records:

>d2wrsa_ d.157.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
eyptvneipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaeaegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsanvlyggcavhelsrtsagnv
adadlaewptsveriqkhypeaevvipghglpggldllqhtanvvkahkn

Timeline for d2wrsa_:

• d2wrsa_ first appeared in SCOPe 2.01
  
• d2wrsa_ appears in SCOPe 2.03
  
• d2wrsa_ appears in SCOPe 2.05
  
• d2wrsa_ appears in the current release, SCOPe 2.08