SCOP 1.73: Domain d1qrjb1: 1qrj B:131-214

Lineage for d1qrjb1 (1qrj B:131-214)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (2 families)

5. Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (4 proteins)

6. Protein HTLV-I capsid protein [47357] (1 species)

7. Species Human T-cell leukemia virus type 1 [TaxId:11908] [47358] (1 PDB entry)

8. Domain d1qrjb1: 1qrj B:131-214 [16952]
   Other proteins in same PDB: d1qrj.1

Details for d1qrjb1

PDB Entry: 1qrj

PDB Description: Solution structure of htlv-i capsid protein

PDB Compounds: (B:) htlv-I capsid protein

SCOP Domain Sequences for d1qrjb1:

Sequence; same for both SEQRES and ATOM records:

>d1qrjb1 a.28.3.1 (B:131-214) HTLV-I capsid protein {Human T-cell leukemia virus type 1 [TaxId: 11908]}
pswasilqgleepyhafverlnialdnglpegtpkdpilrslaysnankecqkllqargh
tnsplgdmlracqtwtpkdktkvl

Timeline for d1qrjb1:

• d1qrjb1 first appeared (with stable ids) in SCOP 1.55
  
• d1qrjb1 appears in SCOP 1.71
  
• d1qrjb1 appears in SCOP 1.75
  
• d1qrjb1 last appears in SCOPe 2.03