PDB entry 1qrj

View 1qrj on RCSB PDB site
Description: solution structure of htlv-I capsid protein
Class: Viral protein
Keywords: htlv-I, capsid protein, retrovirus, two-domain protein, alpha helical protein, heteronuclear nmr spectroscopy, virus/viral protein
Deposited on 1999-06-14, released 1999-07-13
The last revision prior to the SCOP 1.73 freeze date was dated 2001-09-26, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: his tag
    Species: synthetic, synthetic
    Domains in SCOP 1.73: d1qrj.1
  • Chain 'B':
    Compound: htlv-I capsid protein
    Species: Human T-cell leukemia virus type I
    Gene: GAG
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1qrj.1, d1qrjb1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qrjA (A:)
hhhhhssghiegrhm

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qrjB (B:)
qmkdlqaikqevsqaapgspqfmqtirlavqqfdptakdlqdllqylcsslvaslhhqql
dsliseaetrgitgynplagplrvqannpqqqglrreyqqlwlaafaalpgsakdpswas
ilqgleepyhafverlnialdnglpegtpkdpilrslaysnankecqkllqarghtnspl
gdmlracqtwtpkdktkvl