Lineage for d2wnve_ (2wnv E:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1532068Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 1532069Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 1532070Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 1532317Protein automated matches [190204] (3 species)
    not a true protein
  7. 1532318Species Human (Homo sapiens) [TaxId:9606] [186956] (8 PDB entries)
  8. 1532320Domain d2wnve_: 2wnv E: [169492]
    Other proteins in same PDB: d2wnva_, d2wnvc_, d2wnvd_, d2wnvf_
    automated match to d1pk6b_
    complexed with 2dr, ca, nag

Details for d2wnve_

PDB Entry: 2wnv (more details), 1.25 Å

PDB Description: complex between c1q globular heads and deoxyribose
PDB Compounds: (E:) complement c1q subcomponent subunit b

SCOPe Domain Sequences for d2wnve_:

Sequence, based on SEQRES records: (download)

>d2wnve_ b.22.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassrgn
lcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmegan
sifsgfllfpdm

Sequence, based on observed residues (ATOM records): (download)

>d2wnve_ b.22.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qkiafsatrtiplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassrgnlc
vnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmegansi
fsgfllfpdm

SCOPe Domain Coordinates for d2wnve_:

Click to download the PDB-style file with coordinates for d2wnve_.
(The format of our PDB-style files is described here.)

Timeline for d2wnve_: