Lineage for d2wnub_ (2wnu B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1306419Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 1306420Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 1306421Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 1306661Protein automated matches [190204] (3 species)
    not a true protein
  7. 1306662Species Human (Homo sapiens) [TaxId:9606] [186956] (7 PDB entries)
  8. 1306668Domain d2wnub_: 2wnu B: [169486]
    Other proteins in same PDB: d2wnua_, d2wnuc_, d2wnud_, d2wnuf_
    automated match to d1pk6b_
    complexed with nag

Details for d2wnub_

PDB Entry: 2wnu (more details), 2.3 Å

PDB Description: complex between c1q globular heads and heparan sulfate
PDB Compounds: (B:) complement c1q subcomponent subunit b

SCOPe Domain Sequences for d2wnub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wnub_ b.22.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassrg
nlcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmega
nsifsgfllfpdm

SCOPe Domain Coordinates for d2wnub_:

Click to download the PDB-style file with coordinates for d2wnub_.
(The format of our PDB-style files is described here.)

Timeline for d2wnub_: