SCOPe 2.03: Domain d2wm1a_: 2wm1 A:

Lineage for d2wm1a_ (2wm1 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.0: automated matches [191327] (1 protein)
   not a true family

6. Protein automated matches [190150] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189102] (2 PDB entries)

8. Domain d2wm1a_: 2wm1 A: [169441]
   automated match to d2hbva1
   complexed with 13p, gol, zn

Details for d2wm1a_

PDB Entry: 2wm1, 2.01 Å

PDB Description: the crystal structure of human alpha-amino-beta-carboxymuconate-epsilon-semialdehyde decarboxylase in complex with 1,3- dihydroxyacetonephosphate suggests a regulatory link between nad synthesis and glycolysis

PDB Compounds: (A:) 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase

SCOPe Domain Sequences for d2wm1a_:

Sequence; same for both SEQRES and ATOM records:

>d2wm1a_ c.1.9.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkidihshilpkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvrencwdpevri
remdqkgvtvqalstvpvmfsywakpedtlnlcqllnndlastvvsyprrfvglgtlpmq
apelavkemercvkelgfpgvqigthvnewdlnaqelfpvyaaaerlkcslfvhpwdmqm
dgrmakywlpwlvgmpaettiaicsmimggvfekfpklkvcfahgggafpftvgrishgf
smrpdlcaqdnpmnpkkylgsfytdalvhdplslklltdvigkdkvilgtdypfplgele
pgkliesmeefdeetknklkagnalaflgler

Timeline for d2wm1a_:

• d2wm1a_ first appeared in SCOPe 2.01
  
• d2wm1a_ appears in SCOPe 2.02
  
• d2wm1a_ appears in SCOPe 2.04
  
• d2wm1a_ appears in the current release, SCOPe 2.08