SCOPe 2.03: Domain d2wfra_: 2wfr A:

Lineage for d2wfra_ (2wfr A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta

4. Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families)
   zinc-binding motif

5. Family d.65.1.2: Hedgehog (development protein), N-terminal signaling domain [55170] (3 proteins)
   automatically mapped to Pfam PF01085

6. Protein automated matches [190324] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188953] (15 PDB entries)

8. Domain d2wfra_: 2wfr A: [169317]
   automated match to d1vhha_
   complexed with ca, so4, zn

Details for d2wfra_

PDB Entry: 2wfr, 1.95 Å

PDB Description: crystal structure of the n-terminal signalling domain of human dhh with calcium

PDB Compounds: (A:) desert hedgehog protein n-product

SCOPe Domain Sequences for d2wfra_:

Sequence; same for both SEQRES and ATOM records:

>d2wfra_ d.65.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlvpllykqfvpgvpertlgasgpaegrvargserfrdlvpnynpdiifkdeensgadrl
mterckervnalaiavmnmwpgvrlrvtegwdedghhaqdslhyegraldittsdrdrnk
ygllarlaveagfdwvyyesrnhvhvsvkadnslavklehhhhhh

Timeline for d2wfra_:

• d2wfra_ first appeared in SCOPe 2.01
  
• d2wfra_ appears in SCOPe 2.02
  
• d2wfra_ appears in SCOPe 2.04
  
• d2wfra_ appears in the current release, SCOPe 2.08, called d2wfra1