SCOPe 2.03: Domain d2wfma_: 2wfm A:

Lineage for d2wfma_ (2wfm A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.20: Hydroxynitrile lyase-like [53585] (3 proteins)
   automatically mapped to Pfam PF12697

6. Protein automated matches [191073] (1 species)
   not a true protein

7. Species Rauvolfia serpentina [TaxId:4060] [188982] (3 PDB entries)

8. Domain d2wfma_: 2wfm A: [169311]
   automated match to d1y7he_
   mutant

Details for d2wfma_

PDB Entry: 2wfm, 2.2 Å

PDB Description: crystal structure of polyneuridine aldehyde esterase mutant (h244a)

PDB Compounds: (A:) polyneuridine aldehyde esterase

SCOPe Domain Sequences for d2wfma_:

Sequence; same for both SEQRES and ATOM records:

>d2wfma_ c.69.1.20 (A:) automated matches {Rauvolfia serpentina [TaxId: 4060]}
qqkhfvlvhggclgawiwyklkpllesaghkvtavdlsaaginprrldeihtfrdysepl
mevmasippdekvvllghsfggmslglametypekisvavfmsammpdpnhsltypfeky
nekcpadmmldsqfstygnpenpgmsmilgpqfmalkmfqncsvedlelakmltrpgslf
fqdlakakkfsterygsvkrayifcnedksfpvefqkwfvesvgadkvkeikeadamgml
sqprevckclldisd

Timeline for d2wfma_:

• d2wfma_ first appeared in SCOPe 2.01
  
• d2wfma_ appears in SCOPe 2.02
  
• d2wfma_ appears in SCOPe 2.04
  
• d2wfma_ appears in the current release, SCOPe 2.08