Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins) |
Protein automated matches [190245] (11 species) not a true protein |
Species Thermotoga maritima [TaxId:2336] [187021] (20 PDB entries) |
Domain d2wc4b_: 2wc4 B: [169203] automated match to d1od0b_ complexed with act, amf, ca, edo |
PDB Entry: 2wc4 (more details), 1.7 Å
SCOPe Domain Sequences for d2wc4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wc4b_ c.1.8.4 (B:) automated matches {Thermotoga maritima [TaxId: 2336]} vkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk edieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhw dlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhap gmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrfm hqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkf dpdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvse dgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdys tqkrivkdsgywysnvvknngle
Timeline for d2wc4b_: