Lineage for d2w9sd_ (2w9s D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1618271Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1618272Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1618684Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 1618685Protein automated matches [190777] (17 species)
    not a true protein
  7. 1618858Species Staphylococcus aureus [TaxId:1280] [188848] (7 PDB entries)
  8. 1618865Domain d2w9sd_: 2w9s D: [169148]
    automated match to d1dhja_
    complexed with gol, ndp, top

Details for d2w9sd_

PDB Entry: 2w9s (more details), 1.8 Å

PDB Description: staphylococcus aureus s1:dhfr in complex with trimethoprim
PDB Compounds: (D:) dihydrofolate reductase type 1 from tn4003

SCOPe Domain Sequences for d2w9sd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w9sd_ c.71.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 1280]}
tlsiivahdkqrvigyqnqlpwhlpndlkhikqlttgntlvmarktfesigkplpnrrnv
vltnqasfhhegvdvinsldeikelsghvfifggqtlyeamidqvddmyitvidgkfqgd
tffppytfedwevessvegqldekntiphtflhlvrr

SCOPe Domain Coordinates for d2w9sd_:

Click to download the PDB-style file with coordinates for d2w9sd_.
(The format of our PDB-style files is described here.)

Timeline for d2w9sd_: