SCOPe 2.03: Domain d2vnzx_: 2vnz X:

Lineage for d2vnzx_ (2vnz X:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein automated matches [190089] (5 species)
   not a true protein

7. Species Soybean (Glycine max) [TaxId:3847] [187116] (17 PDB entries)

8. Domain d2vnzx_: 2vnz X: [168741]
   automated match to d1oafa_
   complexed with hem, na; mutant

Details for d2vnzx_

PDB Entry: 2vnz, 1.3 Å

PDB Description: crystal structure of dithinonite reduced soybean ascorbate peroxidase mutant w41a.

PDB Compounds: (X:) ascorbate peroxidase

SCOPe Domain Sequences for d2vnzx_:

Sequence; same for both SEQRES and ATOM records:

>d2vnzx_ a.93.1.1 (X:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
gksyptvsadyqkavekakkklrgfiaekrcaplmlrlaahsagtfdkgtktggpfgtik
hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts
nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk
lselgfad

Timeline for d2vnzx_:

• d2vnzx_ first appeared in SCOPe 2.01
  
• d2vnzx_ appears in SCOPe 2.02
  
• d2vnzx_ appears in SCOPe 2.04
  
• d2vnzx_ appears in the current release, SCOPe 2.08