SCOP 1.61: Domain d1hulb_: 1hul B:

Lineage for d1hulb_ (1hul B:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)

4. Superfamily a.26.1: 4-helical cytokines [47266] (3 families)

5. Family a.26.1.2: Short-chain cytokines [47286] (10 proteins)

6. Protein Interleukin-5 [47293] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47294] (1 PDB entry)

8. Domain d1hulb_: 1hul B: [16866]

Details for d1hulb_

PDB Entry: 1hul, 2.4 Å

PDB Description: a novel dimer configuration revealed by the crystal structure at 2.4 angstroms resolution of human interleukin-5

SCOP Domain Sequences for d1hulb_:

Sequence; same for both SEQRES and ATOM records:

>d1hulb_ a.26.1.2 (B:) Interleukin-5 {Human (Homo sapiens)}
iptsalvketlallsthrtllianetlripvpvhknhqlcteeifqgigtlesqtvqggt
verlfknlslikkyidgqkkkcgeerrrvnqfldylqeflgvmntewi

Timeline for d1hulb_:

• d1hulb_ first appeared (with stable ids) in SCOP 1.55
  
• d1hulb_ appears in SCOP 1.59
  
• d1hulb_ appears in SCOP 1.63
  
• d1hulb_ appears in the current release, SCOPe 2.08