Lineage for d2vi8a_ (2vi8 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2503664Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2503908Protein Serine hydroxymethyltransferase [53429] (8 species)
  7. 2503909Species Bacillus stearothermophilus [TaxId:1422] [75272] (39 PDB entries)
  8. 2503913Domain d2vi8a_: 2vi8 A: [168633]
    automated match to d1kkja_
    complexed with mpd, plp, po4

Details for d2vi8a_

PDB Entry: 2vi8 (more details), 1.67 Å

PDB Description: crystal structure of s172absshmt internal aldimine
PDB Compounds: (A:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d2vi8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vi8a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]}
mkylpqqdpqvfaaieqerkrqhakieliasenfvsravmeaqgsvltnkyaegypgrry
yggceyvdiveelarerakqlfgaehanvqphsgaqanmavyftvlehgdtvlgmnlshg
ghlthgspvnfsgvqynfvaygvdpethvidyddvrekarlhrpklivaaaaaypriidf
akfreiadevgaylmvdmahiaglvaaglhpnpvpyahfvtttthktlrgprggmilcqe
qfakqidkaifpgiqggplmhviaakavafgealqddfkayakrvvdnakrlasalqneg
ftlvsggtdnhlllvdlrpqqltgktaekvldevgitvnkntipydpespfvtsgirigt
aavttrgfgleemdeiaaiiglvlknvgseqaleearqrvaaltd

SCOPe Domain Coordinates for d2vi8a_:

Click to download the PDB-style file with coordinates for d2vi8a_.
(The format of our PDB-style files is described here.)

Timeline for d2vi8a_: