Class a: All alpha proteins [46456] (289 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
Protein Erythropoietin [47287] (1 species) long chain cytokine with a short-chain cytokine topology |
Species Human (Homo sapiens) [TaxId:9606] [47288] (3 PDB entries) |
Domain d1buya_: 1buy A: [16848] |
PDB Entry: 1buy (more details)
SCOPe Domain Sequences for d1buya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1buya_ a.26.1.2 (A:) Erythropoietin {Human (Homo sapiens) [TaxId: 9606]} apprlicdsrvlerylleakeaekittgcaehcslnekitvpdtkvnfyawkrmevgqqa vevwqglallseavlrgqallvkssqpweplqlhvdkavsglrslttllralgaqkeais ppdaasaaplrtitadtfrklfrvysnflrgklklytgeacrtgdr
Timeline for d1buya_: