Lineage for d2vdhl_ (2vdh L:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564397Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2564398Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2564399Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2564400Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (9 species)
  7. 2564419Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69758] (6 PDB entries)
  8. 2564443Domain d2vdhl_: 2vdh L: [168467]
    Other proteins in same PDB: d2vdha1, d2vdha2, d2vdhb1, d2vdhb2, d2vdhc1, d2vdhc2, d2vdhd1, d2vdhd2, d2vdhe1, d2vdhe2, d2vdhf1, d2vdhf2, d2vdhg1, d2vdhg2, d2vdhh1, d2vdhh2
    automated match to d2v63i1
    complexed with cap, edo, mg; mutant

Details for d2vdhl_

PDB Entry: 2vdh (more details), 2.3 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with a large-subunit c172s mutation
PDB Compounds: (L:) ribulose bisphosphate carboxylase small chain 1

SCOPe Domain Sequences for d2vdhl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vdhl_ d.73.1.1 (L:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
flvqrpktardfqpankrsv

SCOPe Domain Coordinates for d2vdhl_:

Click to download the PDB-style file with coordinates for d2vdhl_.
(The format of our PDB-style files is described here.)

Timeline for d2vdhl_: