Lineage for d2vc6b_ (2vc6 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2445167Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [188471] (1 PDB entry)
  8. 2445169Domain d2vc6b_: 2vc6 B: [168455]
    automated match to d1dhpa_

Details for d2vc6b_

PDB Entry: 2vc6 (more details), 1.95 Å

PDB Description: structure of mosa from s. meliloti with pyruvate bound
PDB Compounds: (B:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d2vc6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vc6b_ c.1.10.0 (B:) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}
mfegsitalvtpfaddridevalhdlvewqieegsfglvpcgttgesptlskseheqvve
itiktangrvpviagagsnstaeaiafvrhaqnagadgvlivspyynkptqegiyqhfka
idaastipiivynipgrsaieihvetlarifedcpnvkgvkdatgnllrpslermacged
fnlltgedgtalgymahgghgcisvtanvapalcadfqqaclngdfaaalklqdrlmplh
ralfletnpagakyalqrlgrmrgdlrlplvtispsfqeeiddamrhagill

SCOPe Domain Coordinates for d2vc6b_:

Click to download the PDB-style file with coordinates for d2vc6b_.
(The format of our PDB-style files is described here.)

Timeline for d2vc6b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2vc6a_