SCOPe 2.03: Domain d2v2la_: 2v2l A:

Lineage for d2v2la_ (2v2l A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (22 species)
   not a true protein

7. Species Horse (Equus caballus) [TaxId:9796] [187199] (6 PDB entries)

8. Domain d2v2la_: 2v2l A: [168312]
   automated match to d1data_
   complexed with cd, gol, so4; mutant

Details for d2v2la_

PDB Entry: 2v2l, 1.9 Å

PDB Description: Mutant (E53,56,57,60Q) recombinant horse spleen apoferritin cocrystallized with haemin in acidic conditions

PDB Compounds: (A:) ferritin light chain

SCOPe Domain Sequences for d2v2la_:

Sequence; same for both SEQRES and ATOM records:

>d2v2la_ a.25.1.1 (A:) automated matches {Horse (Equus caballus) [TaxId: 9796]}
sqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrqlaqqkrqg
aerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaqa
dphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlk

Timeline for d2v2la_:

• d2v2la_ first appeared in SCOPe 2.01
  
• d2v2la_ appears in SCOPe 2.02
  
• d2v2la_ appears in SCOPe 2.04
  
• d2v2la_ appears in the current release, SCOPe 2.08