Lineage for d2uxfa_ (2uxf A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1302646Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1302647Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1302648Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 1303132Protein automated matches [190545] (6 species)
    not a true protein
  7. 1303133Species Achromobacter cycloclastes [TaxId:223] [188032] (5 PDB entries)
  8. 1303139Domain d2uxfa_: 2uxf A: [168212]
    automated match to d1bqka_
    complexed with cl, cu, gol

Details for d2uxfa_

PDB Entry: 2uxf (more details), 2 Å

PDB Description: pseudoazurin with engineered amicyanin ligand loop, oxidized form, ph 5.5
PDB Compounds: (A:) pseudoazurin

SCOPe Domain Sequences for d2uxfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxfa_ b.6.1.1 (A:) automated matches {Achromobacter cycloclastes [TaxId: 223]}
adfevhmlnkgkdgamvfepaslkvapgdtvtfiptdkghnvetikgmipdgaeafkski
nenykvtftapgvygvkctphpfmvgvvqvgdapanleavkgaknpkkaqerldaalaal
gn

SCOPe Domain Coordinates for d2uxfa_:

Click to download the PDB-style file with coordinates for d2uxfa_.
(The format of our PDB-style files is described here.)

Timeline for d2uxfa_: