Lineage for d2r94d_ (2r94 D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2445304Species Thermoproteus tenax [TaxId:2271] [188383] (2 PDB entries)
  8. 2445312Domain d2r94d_: 2r94 D: [168020]
    automated match to d1w37a_
    complexed with pyr

Details for d2r94d_

PDB Entry: 2r94 (more details), 2.2 Å

PDB Description: crystal structure of kd(p)ga from t.tenax
PDB Compounds: (D:) 2-Keto-3-deoxy-(6-phospho-)gluconate aldolase

SCOPe Domain Sequences for d2r94d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r94d_ c.1.10.0 (D:) automated matches {Thermoproteus tenax [TaxId: 2271]}
meivapvittfrggrldpelfanhvknitskgvdvvfvagttglgpalslqekmeltdaa
tsaarrvivqvaslnadeaialakyaesrgaeavaslppyyfprlserqiakyfrdlcsa
vsipvflynypaavgrdvdaraakelgcirgvkdtneslahtlaykrylpqarvyngsds
lvfasfavrldgvvassanylpellagirdavaagdierarslqflldeivesarhigya
aavyelveifqgyeageprgpvypldpeekawlraavakak

SCOPe Domain Coordinates for d2r94d_:

Click to download the PDB-style file with coordinates for d2r94d_.
(The format of our PDB-style files is described here.)

Timeline for d2r94d_: