SCOPe 2.08: Domain d1r2fb_: 1r2f B:

Lineage for d1r2fb_ (1r2f B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (10 species)

7. Species Salmonella typhimurium [TaxId:90371] [47259] (3 PDB entries)

8. Domain d1r2fb_: 1r2f B: [16801]
   complexed with fe

Details for d1r2fb_

PDB Entry: 1r2f, 2.1 Å

PDB Description: ribonucleotide reductase r2f protein from salmonella typhimurium

PDB Compounds: (B:) protein (ribonucleotide reductase r2)

SCOPe Domain Sequences for d1r2fb_:

Sequence; same for both SEQRES and ATOM records:

>d1r2fb_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Salmonella typhimurium [TaxId: 90371]}
isainwnkiqddkdlevwnrltsnfwlpekvplsndipawqtlsaaeqqltirvftgltl
ldtiqniagapslmadaitpheeavlsnisfmeavharsyssifstlcqtkevdaayaws
eenpplqrkaqiilahyvsdeplkkkiasvflesflfysgfwlpmyfssrgkltntadli
rliirdeavhgyyigykyqialqklsaiereelklfaldllmelydneirytealyaetg
wvndvkaflcynankalmnlgyealfppemadvnpailaal

Timeline for d1r2fb_:

• d1r2fb_ first appeared (with stable ids) in SCOP 1.55
  
• d1r2fb_ appears in SCOPe 2.07