Lineage for d1mhzb_ (1mhz B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2316569Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2316654Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. 2316712Species Methylosinus trichosporium [TaxId:426] [88794] (2 PDB entries)
  8. 2316714Domain d1mhzb_: 1mhz B: [16783]
    Other proteins in same PDB: d1mhzd_, d1mhzg_
    complexed with fe

Details for d1mhzb_

PDB Entry: 1mhz (more details), 2.7 Å

PDB Description: methane monooxygenase hydroxylase
PDB Compounds: (B:) methane monooxygenase hydroxylase

SCOPe Domain Sequences for d1mhzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhzb_ a.25.1.2 (B:) Methane monooxygenase hydrolase beta subunit {Methylosinus trichosporium [TaxId: 426]}
krgltdperaaiiaaavpdhaldtqrkyhyfiqprwkplseyeqlscyaqpnpdwiaggl
dwgdwtqkfhggrpswgnestelrttdwyrhrdparrwhhpyvkdkseearytqrflaay
ssegsirtidpywrdeilnkyfgallyseyglfnahssvgrdclsdtirqtavfaaldkv
dnaqmiqmerlfiaklvpgfdastdvpkkiwttdpiysgaratvqeiwqgvqdwneilwa
ghavydatfgqfarreffqrlatvygdtltpfftaqsqtyfqttrgaiddlfvyclands
efgahnrtflnawtehylassvaalkdfvglyakvekvagatdsagvsealqrvfgdwki
dyadkigfrvdvdqkvdavlagy

SCOPe Domain Coordinates for d1mhzb_:

Click to download the PDB-style file with coordinates for d1mhzb_.
(The format of our PDB-style files is described here.)

Timeline for d1mhzb_: