Lineage for d1mhzb_ (1mhz B:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 212183Fold a.25: Ferritin-like [47239] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 212184Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
    contains dimetal-ion centre in the middle of the bundle
  5. 212337Family a.25.1.2: Ribonucleotide reductase-like [47253] (4 proteins)
  6. 212362Protein Methane monooxygenase hydrolase, beta and alpha subunits [47254] (2 species)
  7. 212424Species Methylosinus trichosporium [TaxId:426] [47256] (2 PDB entries)
  8. 212427Domain d1mhzb_: 1mhz B: [16783]
    Other proteins in same PDB: d1mhzg_
    complexed with fe

Details for d1mhzb_

PDB Entry: 1mhz (more details), 2.7 Å

PDB Description: methane monooxygenase hydroxylase

SCOP Domain Sequences for d1mhzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhzb_ a.25.1.2 (B:) Methane monooxygenase hydrolase, beta and alpha subunits {Methylosinus trichosporium}
krgltdperaaiiaaavpdhaldtqrkyhyfiqprwkplseyeqlscyaqpnpdwiaggl
dwgdwtqkfhggrpswgnestelrttdwyrhrdparrwhhpyvkdkseearytqrflaay
ssegsirtidpywrdeilnkyfgallyseyglfnahssvgrdclsdtirqtavfaaldkv
dnaqmiqmerlfiaklvpgfdastdvpkkiwttdpiysgaratvqeiwqgvqdwneilwa
ghavydatfgqfarreffqrlatvygdtltpfftaqsqtyfqttrgaiddlfvyclands
efgahnrtflnawtehylassvaalkdfvglyakvekvagatdsagvsealqrvfgdwki
dyadkigfrvdvdqkvdavlagy

SCOP Domain Coordinates for d1mhzb_:

Click to download the PDB-style file with coordinates for d1mhzb_.
(The format of our PDB-style files is described here.)

Timeline for d1mhzb_: