Lineage for d1mhyb_ (1mhy B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703310Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2703395Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. 2703453Species Methylosinus trichosporium [TaxId:426] [88794] (2 PDB entries)
  8. 2703454Domain d1mhyb_: 1mhy B: [16781]
    Other proteins in same PDB: d1mhyd_, d1mhyg_
    complexed with fe
    has additional insertions and/or extensions that are not grouped together

Details for d1mhyb_

PDB Entry: 1mhy (more details), 2 Å

PDB Description: methane monooxygenase hydroxylase
PDB Compounds: (B:) methane monooxygenase hydroxylase

SCOPe Domain Sequences for d1mhyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhyb_ a.25.1.2 (B:) Methane monooxygenase hydrolase beta subunit {Methylosinus trichosporium [TaxId: 426]}
krgltdperaaiiaaavpdhaldtqrkyhyfiqprwkplseyeqlscyaqpnpdwiaggl
dwgdwtqkfhggrpswgnestelrttdwyrhrdparrwhhpyvkdkseearytqrflaay
ssegsirtidpywrdeilnkyfgallyseyglfnahssvgrdclsdtirqtavfaaldkv
dnaqmiqmerlfiaklvpgfdastdvpkkiwttdpiysgaratvqeiwqgvqdwneilwa
ghavydatfgqfarreffqrlatvygdtltpfftaqsqtyfqttrgaiddlfvyclands
efgahnrtflnawtehylassvaalkdfvglyakvekvagatdsagvsealqrvfgdwki
dyadkigfrvdvdqkvdavlagy

SCOPe Domain Coordinates for d1mhyb_:

Click to download the PDB-style file with coordinates for d1mhyb_.
(The format of our PDB-style files is described here.)

Timeline for d1mhyb_: