![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) ![]() |
![]() | Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins) |
![]() | Protein automated matches [190030] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187366] (4 PDB entries) |
![]() | Domain d2qkqa_: 2qkq A: [167699] automated match to d1b4fb_ complexed with cl |
PDB Entry: 2qkq (more details), 2.1 Å
SCOPe Domain Sequences for d2qkqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qkqa_ a.60.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} afgsvgewlraikmgryeesfaaagfgsfelvsqisaedllrigvtlaghqkkilasvqh m
Timeline for d2qkqa_: