Lineage for d2qkef_ (2qke F:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1370026Family c.47.1.15: KaiB-like [102449] (3 proteins)
    Pfam PF07689; contains members with alternative folds
  6. 1370035Protein automated matches [190797] (4 species)
    not a true protein
  7. 1370038Species Synechococcus elongatus [TaxId:32046] [188470] (2 PDB entries)
  8. 1370044Domain d2qkef_: 2qke F: [167697]
    automated match to d1r5pb_

Details for d2qkef_

PDB Entry: 2qke (more details), 2.7 Å

PDB Description: Wild Type Crystal Structure of Full Length Circadian Clock Protein KaiB from Thermosynechococcus elongatus BP-1
PDB Compounds: (F:) Circadian clock protein kaiB

SCOPe Domain Sequences for d2qkef_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qkef_ c.47.1.15 (F:) automated matches {Synechococcus elongatus [TaxId: 32046]}
aplrktyvlklyvagntpnsvralktlnnilekefkgvyalkvidvlknpqlaeedkila
tptlakvlpppvrriigdlsnrekvligldllyeeigdqa

SCOPe Domain Coordinates for d2qkef_:

Click to download the PDB-style file with coordinates for d2qkef_.
(The format of our PDB-style files is described here.)

Timeline for d2qkef_: